PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g30660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 306aa    MW: 34073.7 Da    PI: 4.5905
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g30660genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.48.2e-18200234135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Tp7g30660 200 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 234
                99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-1001290IPR016679Transcription factor, GATA, plant
SMARTSM004012.1E-17194244IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.438194230IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.38E-15197258No hitNo description
Gene3DG3DSA:3.30.50.102.3E-14198232IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.43E-15199246No hitNo description
PfamPF003201.1E-15200234IPR000679Zinc finger, GATA-type
PROSITE patternPS003440200225IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MEQQLTPELF LVDDLLDFSN DDGQPDDGFE SFPDSFTLSA GNLADSSNSS SLYTDGSGFS  60
DDLCVPCEDL AELEWLSNFV EESFSKEDQD KLQLLSGLKK PQTTGLTQTH QIKPEPEPEP  120
ELDHIFIPTD TDTDDSNIAV PAKARSKRSR SAASTWASRL LAIAGSDESG PKKKHLRIKE  180
PESAGEIDFE GGETGGERRC LHCATDKTPQ WRTGPMGPKT LCNACGVRYK SGRLVPEYRP  240
ASSPTFVMAR HSNSHRKVME LRRQKEMRDE HLLSQLRCEN FLMDIKSNGD DFLIHNNNHV  300
APDLDT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895650.0AC189565.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH009C15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412416.10.0hypothetical protein EUTSA_v10025757mg
SwissprotO826321e-168GATA9_ARATH; GATA transcription factor 9
TrEMBLV4MBT30.0V4MBT3_EUTSA; Uncharacterized protein
STRINGBra037037.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-154GATA transcription factor 9